PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0098.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 246aa    MW: 29141.3 Da    PI: 5.0474
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0098.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.1e-192275356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          + ++f++eq++ Le +Fe++  +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Bostr.25993s0098.1.p 22 NQRRFSDEQIKSLEMMFESETRLEPKKKVQLARELGLQPRQVAIWFQNKRARWK 75
                          6689*************************************************9 PP

2HD-ZIP_I/II124.93.8e-4022113293
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           ++rr+s+eq+k+LE++Fe+e++Lep++Kv+lareLglqprqva+WFqn+RAR+k+kqlE++y+ L+++yd+l+++ e+L+ke+++L +e
  Bostr.25993s0098.1.p  22 NQRRFSDEQIKSLEMMFESETRLEPKKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSE 110
                           68**************************************************************************************9 PP

           HD-ZIP_I/II  91 lke 93 
                           l++
  Bostr.25993s0098.1.p 111 LQK 113
                           987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-181079IPR009057Homeodomain-like
PROSITE profilePS5007117.2971777IPR001356Homeobox domain
CDDcd000869.83E-152078No hitNo description
SMARTSM003893.7E-162081IPR001356Homeobox domain
PfamPF000461.8E-162275IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-192384IPR009057Homeodomain-like
PRINTSPR000317.2E-64857IPR000047Helix-turn-helix motif
PROSITE patternPS0002705275IPR017970Homeobox, conserved site
PRINTSPR000317.2E-65773IPR000047Helix-turn-helix motif
PfamPF021837.1E-1677118IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MMSSDPFMSM KKMKKSNHIK NNQRRFSDEQ IKSLEMMFES ETRLEPKKKV QLARELGLQP  60
RQVAIWFQNK RARWKSKQLE TEYNILRQNY DNLASQFESL KKEKQALVSE LQKLNEAMHQ  120
TKEEERQCCG DQAVVALSST DHESENEEKH RRCEPEEVRP EMEMYDEKGH HGVLSHDDYD  180
DEDGYNNNIK REYFGGFEEE PDHLMNIVEP ADSCLTSSDD WRGFKSDTTL LHQSSSNYPW  240
WDFWS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0458260.0AY045826.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-7 (At2g46680) mRNA, complete cds.
GenBankAY0913640.0AY091364.1 Arabidopsis thaliana putative homeodomain transcription factor protein ATHB-7 (At2g46680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294845.11e-160hypothetical protein CARUB_v10023896mg
SwissprotP468971e-154ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLR0HUH21e-160R0HUH2_9BRAS; Uncharacterized protein
STRINGAT2G46680.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-148homeobox 7